Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERP5, Dermatophagoides pteronyssinus (His)

DERP5 protein exhibits a monomeric structure and forms homodimeric trimers through concentration-dependent oligomerization, which plays a key role in allergic reactions. Multiple population studies have shown that DERP5 binds to IgE and is associated with mite allergy symptoms such as asthma and rhinitis. DERP5 Protein, Dermatophagoides pteronyssinus (His) is the recombinant DERP5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

DERP5 Protein, Dermatophagoides pteronyssinus (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/derp5-protein-dermatophagoides-pteronyssinus-his.html

Purity

95.60

Smiles

MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIEV

Molecular Formula

113793750 (Gene_ID) P14004 (M1-V132) (Accession)

Molecular Weight

Approximately 15 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defensin-1, beta (Defensin, beta-1) (APC)
MBS6124858-01 0.01 mL

Defensin-1, beta (Defensin, beta-1) (APC)

Sign In for Pricing
View Details
Defensin-1, beta (Defensin, beta-1) (APC)
MBS6124858-02 5x 0.01 mL

Defensin-1, beta (Defensin, beta-1) (APC)

Sign In for Pricing
View Details
AGP-2 CRISPR/Cas9 KO Plasmid (h)
sc-417370 20 µg

AGP-2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Volumetric Sol Potassium Iodide 3.0M (3.0N) - 5L
K12305 5 L

Volumetric Sol Potassium Iodide 3.0M (3.0N) - 5L

Sign In for Pricing
View Details
VTA1 Antibody
KC-17262-01 50 μL

VTA1 Antibody

Sign In for Pricing
View Details
VTA1 Antibody
KC-17262-02 100 µL

VTA1 Antibody

Sign In for Pricing
View Details