Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC5, Human (His)

The CLIC5 protein is essential for normal hearing and contributes to the formation of stereocilia and the development of the organ of Corti in the inner ear. It forms poorly selective ion channels that may transport chloride ions. CLIC5 Protein, Human (His) is the recombinant human-derived CLIC5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CLIC5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clic5-protein-human-his.html

Purity

98.0

Smiles

MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Molecular Formula

53405 (Gene_ID) Q9NZA1-2 (M1-S251) (Accession)

Molecular Weight

Approximately 37.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) ELISA Kit
DL-GRIA2-Hu-01 48 Tests

Human Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) ELISA Kit
DL-GRIA2-Hu-02 96 Tests

Human Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) ELISA Kit

Sign In for Pricing
View Details
Connective Tissue Growth Factor Human Recombinant, His Tag (CTGF Human, His)
PT_74463-01 5 µg

Connective Tissue Growth Factor Human Recombinant, His Tag (CTGF Human, His)

Sign In for Pricing
View Details
Connective Tissue Growth Factor Human Recombinant, His Tag (CTGF Human, His)
PT_74463-02 20 µg

Connective Tissue Growth Factor Human Recombinant, His Tag (CTGF Human, His)

Sign In for Pricing
View Details
Connective Tissue Growth Factor Human Recombinant, His Tag (CTGF Human, His)
PT_74463-03 1 mg

Connective Tissue Growth Factor Human Recombinant, His Tag (CTGF Human, His)

Sign In for Pricing
View Details
Rab2b Rat shRNA Plasmid (Locus ID 305853)
TR703528 1 Kit

Rab2b Rat shRNA Plasmid (Locus ID 305853)

Sign In for Pricing
View Details