Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XTP3TPA, Human (His)

XTP3TPA protein crucially hydrolyzes deoxynucleoside triphosphates (dNTPs), particularly preferring dCTP and its analogs, like 5-iodo-dCTP and 5-methyl-dCTP. This selective hydrolysis, reflecting high efficiency, likely safeguards against the incorporation of genotoxic nucleotide analogs into DNA or RNA, contributing to genomic integrity and protecting cellular nucleotide pools. XTP3TPA Protein, Human (His) is the recombinant human-derived XTP3TPA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

XTP3TPA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/xtp3tpa-protein-human-his.html

Purity

96.70

Smiles

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Molecular Formula

79077 (Gene_ID) Q9H773 (M1-T170) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details