Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293.html

Purity

96.10

Smiles

PYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDPEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (P21-P730) (Accession)

Molecular Weight

Approximately 80-105 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (Azide free) (HRP)
MBS6331081-01 0.2 mL

PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (Azide free) (HRP)
MBS6331081-02 5x 0.2 mL

PATE1, CT (PATE1, PATE, Prostate and testis expressed protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
Mouse Thrombospondin 4 (THBS4) Protein
abx655227-01 10 µg

Mouse Thrombospondin 4 (THBS4) Protein

Sign In for Pricing
View Details
Mouse Thrombospondin 4 (THBS4) Protein
abx655227-02 50 µg

Mouse Thrombospondin 4 (THBS4) Protein

Sign In for Pricing
View Details
Mouse Thrombospondin 4 (THBS4) Protein
abx655227-03 100 µg

Mouse Thrombospondin 4 (THBS4) Protein

Sign In for Pricing
View Details
Mouse Thrombospondin 4 (THBS4) Protein
abx655227-04 200 µg

Mouse Thrombospondin 4 (THBS4) Protein

Sign In for Pricing
View Details