Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Mouse (HEK293)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration.It is suggested that it may be involved in bone osteoclastic resorption.MMP-9 Protein, Mouse (HEK293) is the recombinant mouse-derived MMP-9 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-9 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-mouse-hek293.html

Purity

96.10

Smiles

PYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDPEVNQVDDVGYVTYDLLQCP

Molecular Formula

17395 (Gene_ID) P41245 (P21-P730) (Accession)

Molecular Weight

Approximately 80-105 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Telomerase Reverse Transcriptase (TERT) Polyclonal Antibody
TRV-0020863-01 50 Tests

Anti-Telomerase Reverse Transcriptase (TERT) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Telomerase Reverse Transcriptase (TERT) Polyclonal Antibody
TRV-0020863-02 100 Tests

Anti-Telomerase Reverse Transcriptase (TERT) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Telomerase Reverse Transcriptase (TERT) Polyclonal Antibody
TRV-0020863-03 200 Tests

Anti-Telomerase Reverse Transcriptase (TERT) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1) , partial
MBS7094302-01 0.02 mg (Mammalian-Cell)

Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1) , partial

Sign In for Pricing
View Details
Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1) , partial
MBS7094302-02 0.1 mg (Mammalian-Cell)

Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1) , partial

Sign In for Pricing
View Details
Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1) , partial
MBS7094302-03 1 mg (Mammalian-Cell)

Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1) , partial

Sign In for Pricing
View Details