Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YY1, Human (His)

The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

YY1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/yy1-protein-human-his.html

Purity

95.0

Smiles

VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHG

Molecular Formula

7528 (Gene_ID) P25490 (V221-G321) (Accession)

Molecular Weight

17-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GLUD1 Rabbit Polyclonal Antibody
AP20095PU-N 1 mg

GLUD1 Rabbit Polyclonal Antibody

Ask
View Details
Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (PE)
MBS6499500-01 0.2 mL

Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (PE)

Ask
View Details
Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (PE)
MBS6499500-02 5x 0.2 mL

Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (PE)

Ask
View Details
TBL3 siRNA (Mouse)
MBS8237836-01 15 nmol

TBL3 siRNA (Mouse)

Ask
View Details
TBL3 siRNA (Mouse)
MBS8237836-02 30 nmol

TBL3 siRNA (Mouse)

Ask
View Details
TBL3 siRNA (Mouse)
MBS8237836-03 5x 30 nmol

TBL3 siRNA (Mouse)

Ask
View Details