YY1, Human (His)
The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
YY1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/yy1-protein-human-his.html
Purity
95.0
Smiles
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHG
Molecular Formula
7528 (Gene_ID) P25490 (V221-G321) (Accession)
Molecular Weight
17-20 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Human Cytochrome C Oxidase subunit VIc (COX6C) activation kit by CRISPRa
Lentiviral human DDI2 shRNA (UAS) - Lentiviral human DDI2 shRNA (UAS, iRFP) plasmid
Lentiviral mouse Slc4a2 shRNA (UAS) - Lentiviral mouse Slc4a2 shRNA (UAS) (25)