YY1, Human (His)
The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
YY1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/yy1-protein-human-his.html
Purity
95.0
Smiles
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHG
Molecular Formula
7528 (Gene_ID) P25490 (V221-G321) (Accession)
Molecular Weight
17-20 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (PE)
Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (PE)
