Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YY1, Human (His)

The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

YY1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/yy1-protein-human-his.html

Purity

95.0

Smiles

VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHG

Molecular Formula

7528 (Gene_ID) P25490 (V221-G321) (Accession)

Molecular Weight

17-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Soluble Adenylate Cyclase, sAC ELISA Kit
NB-E11031-01 96 Well

Human Soluble Adenylate Cyclase, sAC ELISA Kit

Ask
View Details
Human Soluble Adenylate Cyclase, sAC ELISA Kit
NB-E11031-02 96 Well

Human Soluble Adenylate Cyclase, sAC ELISA Kit

Ask
View Details
Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His
AP7F300-01 1 mg

Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His

Ask
View Details
Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His
AP7F300-02 10 µg

Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His

Ask
View Details
Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His
AP7F300-03 200 µg

Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His

Ask
View Details
Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His
AP7F300-04 5 mg

Recombinant Chicken Fibroblast Growth Factor 2, Basic (FGF2), N-His

Ask
View Details