Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM22 (NM_013337) Human Tagged Lenti ORF Clone
RC200858L3 10 µg

TIMM22 (NM_013337) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC14A2 (NM_007163) Human Tagged Lenti ORF Clone
RC213567L4 10 µg

SLC14A2 (NM_007163) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZNF607 sgRNA CRISPR Lentivector set (Human)
K2719301 3x 1.0 µg

ZNF607 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Cdk 2 (Cyclin-dependent Kinase 2) (MaxLight 550) discontinued
C2572-05B-ML550 100 µL

Cdk 2 (Cyclin-dependent Kinase 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human CD79A knockdown cell line
ABC-KD2740 1 Vial

Human CD79A knockdown cell line

Sign In for Pricing
View Details
Rat erythrocyte membrane protein (EMP) ELISA Kit
MBS268708-01 48 Well

Rat erythrocyte membrane protein (EMP) ELISA Kit

Sign In for Pricing
View Details