CD164, Human (HEK293, His)
CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD164 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html
Purity
96.0
Smiles
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Molecular Formula
8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)
Molecular Weight
Approximately 35-95 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Factor VIII (Coagulation Factor VIII, FVIII, F8 Protein, F8B, F8C, Antihemophilic Factor, AHF, Dxs1253e, HEMA, Procoagulant Component) (Not for Export EU)
![Mouse Monoclonal CD1a Antibody (703217) [Janelia Fluor 669]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Mouse Monoclonal CD1a Antibody (703217) [Janelia Fluor 669]