CD164, Human (HEK293, His)
CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD164 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html
Purity
96.0
Smiles
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Molecular Formula
8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)
Molecular Weight
Approximately 35-95 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
CSTF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Lentiviral mouse Crk shRNA (UAS) - Lentiviral mouse Crk shRNA (UAS, GFP) (100)
Syntaxin 18 (Syntaxin-18, STX18, Cell Growth-inhibiting Gene 9 Protein, GIG9, Ufe1) (MaxLight 490)