Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Obacunone
TB0381-0020 20mg

Obacunone

Sign In for Pricing
View Details
Goat Triiodothyronine (T3) ELISA Kit
EIA06395Go 1 Kit

Goat Triiodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Human OR52E2 qPCR Primer Pair
QH60505S 200 Tests

Human OR52E2 qPCR Primer Pair

Sign In for Pricing
View Details
Ganglioside GT1b, Trisialo, Triammonium Salt
sc-221661 1 mg

Ganglioside GT1b, Trisialo, Triammonium Salt

Sign In for Pricing
View Details
pPGK-Fluc-Dazap1-3UTR-mut-hRluc Plasmid
PVT61560 2 µg

pPGK-Fluc-Dazap1-3UTR-mut-hRluc Plasmid

Sign In for Pricing
View Details
SLC39A9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44191111 3x 1.0 µg

SLC39A9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details