Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

G6PR Protein Vector (Human) (pPB-N-His)
PV079802 500 ng

G6PR Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Atp11a (NM_001293667) Mouse Tagged ORF Clone
MR231618 10 µg

Atp11a (NM_001293667) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Paroxetine mesylate
C10834 25 mg

Paroxetine mesylate

Sign In for Pricing
View Details
TRAFD1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-17249 0.1 mg

TRAFD1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
RAMP2 3'UTR GFP Stable Cell Line
TU069485 1.0 mL

RAMP2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
E3 Ubiquitin-Protein Ligase CBL (CBL) Antibody
abx213526-01 50 µL

E3 Ubiquitin-Protein Ligase CBL (CBL) Antibody

Sign In for Pricing
View Details