Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB4 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated
bsm-43150M-BF680 100 µL

SERPINB4 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Bromo PEG
122000-1.1G 1 g

Ɑ-Methoxy-ω-Bromo PEG

Sign In for Pricing
View Details
CDH11 polyclonal antibody
BS75916-01 50 µL

CDH11 polyclonal antibody

Sign In for Pricing
View Details
CDH11 polyclonal antibody
BS75916-02 100 µL

CDH11 polyclonal antibody

Sign In for Pricing
View Details
Ulk3, ID (Ulk3, Serine/threonine-protein kinase ULK3, Unc-51-like kinase 3) (APC) discontinued
043605-APC 200 µL

Ulk3, ID (Ulk3, Serine/threonine-protein kinase ULK3, Unc-51-like kinase 3) (APC) discontinued

Sign In for Pricing
View Details
Rabbit 3-hydroxykynurenine ELISA Kit
MBS7276627-01 48 Well

Rabbit 3-hydroxykynurenine ELISA Kit

Sign In for Pricing
View Details