Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow Heat Shock Protein 90 Alpha (HSP90A) ELISA Kit
abx257484-01 96 Tests

Cow Heat Shock Protein 90 Alpha (HSP90A) ELISA Kit

Sign In for Pricing
View Details
Cow Heat Shock Protein 90 Alpha (HSP90A) ELISA Kit
abx257484-02 5x 96 Tests

Cow Heat Shock Protein 90 Alpha (HSP90A) ELISA Kit

Sign In for Pricing
View Details
Cow Heat Shock Protein 90 Alpha (HSP90A) ELISA Kit
abx257484-03 10x 96 Tests

Cow Heat Shock Protein 90 Alpha (HSP90A) ELISA Kit

Sign In for Pricing
View Details
P2RY11 Antibody
MBS9606590-01 0.1 mL

P2RY11 Antibody

Sign In for Pricing
View Details
P2RY11 Antibody
MBS9606590-02 0.2 mL

P2RY11 Antibody

Sign In for Pricing
View Details
P2RY11 Antibody
MBS9606590-03 5x 0.2 mL

P2RY11 Antibody

Sign In for Pricing
View Details