Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timm17b Mouse qPCR Template Standard (NM_011591)
MK200187 1 Kit

Timm17b Mouse qPCR Template Standard (NM_011591)

Sign In for Pricing
View Details
Lentiviral human NRK shRNA (UAS) - Lentiviral human NRK shRNA (UAS, iRFP) (100)
GTR15119787 1 Vial

Lentiviral human NRK shRNA (UAS) - Lentiviral human NRK shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CALU Recombinant Antibody, APC Conjugated
bsm-62555R-APC 100 µL

CALU Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Bcat1 shRNA (UAS) - Lentiviral mouse Bcat1 shRNA (UAS, iRFP) (25)
GTR15291386 1 Vial

Lentiviral mouse Bcat1 shRNA (UAS) - Lentiviral mouse Bcat1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SNORA72 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44655111 3x 1.0 µg

SNORA72 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0397 protein BCB4264_A2665 (BCB4264_A2665)
MBS7036623-01 0.02 mg

Recombinant Bacillus cereus UPF0397 protein BCB4264_A2665 (BCB4264_A2665)

Sign In for Pricing
View Details