Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse POMGNT1 Protein, His (Fc)-Avi-tagged
POMGNT1-6937M 50 µg

Recombinant Mouse POMGNT1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
pCMV-SPORT6-FMOD Plasmid
PVT16415 2 µg

pCMV-SPORT6-FMOD Plasmid

Sign In for Pricing
View Details
CXorf65 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0540507 1.0 µg DNA

CXorf65 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AF-4 Polyclonal Antibody
UB-GEN-16332 100 µL

AF-4 Polyclonal Antibody

Sign In for Pricing
View Details
DNAJC7 Protein Vector (Mouse) (pPM-C-His)
PV172845 500 ng

DNAJC7 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Sec31a 3'UTR Luciferase Stable Cell Line
TU118504 1.0 mL

Sec31a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details