Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nupr1l Mouse siRNA Oligo Duplex (Locus ID 69034)
SR401121 1 Kit

Nupr1l Mouse siRNA Oligo Duplex (Locus ID 69034)

Sign In for Pricing
View Details
Magnesium chloride hexahydrate, BP, Ph. Eur. grade
GK0382-500g 500 g

Magnesium chloride hexahydrate, BP, Ph. Eur. grade

Sign In for Pricing
View Details
Mouse Capn2 qPCR Primer Pair
QM10510S 200 Tests

Mouse Capn2 qPCR Primer Pair

Sign In for Pricing
View Details
Human Fukutin ELISA KIT
EF009709 96 Tests

Human Fukutin ELISA KIT

Sign In for Pricing
View Details
Guinea pig Collagen autoantibody (CLA) ELISA Kit
EIA05489Gu 1 Kit

Guinea pig Collagen autoantibody (CLA) ELISA Kit

Sign In for Pricing
View Details
BST2 (Bone Marrow Stromal Cell antigen 2, CD317)
243898 100 µL

BST2 (Bone Marrow Stromal Cell antigen 2, CD317)

Sign In for Pricing
View Details