Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-Histone H4 (Lys5) Polyclonal Antibody
E53P01412 100 µL

Acetyl-Histone H4 (Lys5) Polyclonal Antibody

Sign In for Pricing
View Details
Itpr2 sgRNA CRISPR Lentivector set (Rat)
K7566201 3x 1.0 µg

Itpr2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) APC14 Polyclonal Antibody
MBS7179919 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) APC14 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Cdc25B (Ser353) Polyclonal Antibody
bs-5245R 100 µL

Phospho-Cdc25B (Ser353) Polyclonal Antibody

Sign In for Pricing
View Details
AMT, NT (Aminomethyltransferase, Mitochondrial, Glycine Cleavage System T Protein, GCVT, GCST) (MaxLight 650) discontinued
A2273-01-ML650 100 µL

AMT, NT (Aminomethyltransferase, Mitochondrial, Glycine Cleavage System T Protein, GCVT, GCST) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Bovine Oligodendrocyte-Myelin Glycoprotein (OMG) ELISA Kit
MBS9929213-01 48 Well

Bovine Oligodendrocyte-Myelin Glycoprotein (OMG) ELISA Kit

Sign In for Pricing
View Details