Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Akr1b7 activation kit by CRISPRa
GA200353 1 Kit

Mouse Akr1b7 activation kit by CRISPRa

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit
MBS7235964-01 48 Well

Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit
MBS7235964-02 96 Well

Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit
MBS7235964-03 5x 96 Well

Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit

Sign In for Pricing
View Details
Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit
MBS7235964-04 10x 96 Well

Canine Mediator of RNA polymerase II transcription subunit 26 (MED26) ELISA Kit

Sign In for Pricing
View Details
Selplg Recombinant Antibody
RAC07213-01 50 µL

Selplg Recombinant Antibody

Sign In for Pricing
View Details