Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PSMD14 Protein, N-His
YHA13801 100 μg

Recombinant Human PSMD14 Protein, N-His

Sign In for Pricing
View Details
CDC45L (CDC45) Human qPCR Primer Pair (NM_003504)
HP207009 200 Reactions

CDC45L (CDC45) Human qPCR Primer Pair (NM_003504)

Sign In for Pricing
View Details
PHF2P2 Protein Vector (Human) (pPM-C-HA)
PV110840 500 ng

PHF2P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Rpap1 shRNA (UAS) - Lentiviral mouse Rpap1 shRNA (UAS) plasmid
GTR15278443 1 Vial

Lentiviral mouse Rpap1 shRNA (UAS) - Lentiviral mouse Rpap1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human TTC5 Protein - (Dry Ice)
H00091875-P01-25ug 25 µg

Recombinant Human TTC5 Protein - (Dry Ice)

Sign In for Pricing
View Details
Zona pellucida sperm-binding protein 2
MBS7043575-01 0.02 mg

Zona pellucida sperm-binding protein 2

Sign In for Pricing
View Details