Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAMP3 Protein, His, Insect-1mg
QP12532-1mg 1mg

Recombinant Human LAMP3 Protein, His, Insect-1mg

Sign In for Pricing
View Details
HSBP1 Human shRNA Lentiviral Particle (Locus ID 3281)
TL319497V 500 µL Each

HSBP1 Human shRNA Lentiviral Particle (Locus ID 3281)

Sign In for Pricing
View Details
Mouse GYPC shRNA Plasmid
abx977455-01 150 µg

Mouse GYPC shRNA Plasmid

Sign In for Pricing
View Details
Mouse GYPC shRNA Plasmid
abx977455-02 300 µg

Mouse GYPC shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Gramd3 shRNA (UAS) - Lentiviral mouse Gramd3 shRNA (UAS, RFP) (100)
GTR15191652 1 Vial

Lentiviral mouse Gramd3 shRNA (UAS) - Lentiviral mouse Gramd3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-Mouse CD11b/ITGAM Antibody (M1/70), FITC
MY474317-01 1 Each

Anti-Mouse CD11b/ITGAM Antibody (M1/70), FITC

Sign In for Pricing
View Details