Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAC1 (NM_018890) Human Tagged Lenti ORF Clone
RC224262L1 10 µg

RAC1 (NM_018890) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DTWD2 Protein Vector (Rat) (pPB-N-His)
PV264983 500 ng

DTWD2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
COL1A2 Antibody
A48121-100UG 100 µg

COL1A2 Antibody

Sign In for Pricing
View Details
FIB1 Antibody
MBS9006839 10 mg

FIB1 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CNTF Antibody (001) [PE]
NBP2-89998PE 0.1 mL

Rabbit Monoclonal CNTF Antibody (001) [PE]

Sign In for Pricing
View Details
Lentiviral human PUS7 shRNA (UAS) - Lentiviral human PUS7 shRNA (UAS, RFP) plasmid
GTR15340420 1 Vial

Lentiviral human PUS7 shRNA (UAS) - Lentiviral human PUS7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details