Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-human-hek293-his.html

Purity

96.0

Smiles

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Formula

8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)

Molecular Weight

Approximately 35-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl32 Mouse shRNA Lentiviral Particle (Locus ID 212390)
TL510762V 500 µL Each

Klhl32 Mouse shRNA Lentiviral Particle (Locus ID 212390)

Sign In for Pricing
View Details
Rabbit Anti-Human RHOU pAb
PA10768-01 50 μL

Rabbit Anti-Human RHOU pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RHOU pAb
PA10768-02 100 μL

Rabbit Anti-Human RHOU pAb

Sign In for Pricing
View Details
CASQ1 Antibody, FITC conjugated
A16038-100UG 100 µg

CASQ1 Antibody, FITC conjugated

Sign In for Pricing
View Details
BTZ043 10mg
A21263-10 10 mg

BTZ043 10mg

Sign In for Pricing
View Details
AGPAT3 Antibody
A67240-50UG 50 µg

AGPAT3 Antibody

Sign In for Pricing
View Details