Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (Azide free) (HRP)
MBS6314396-01 0.2 mL

KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (Azide free) (HRP)

Ask
View Details
KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (Azide free) (HRP)
MBS6314396-02 5x 0.2 mL

KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (Azide free) (HRP)

Ask
View Details
Peristaltic Pump; Constant-current Pump
E0867 1 Unit

Peristaltic Pump; Constant-current Pump

Ask
View Details
SYT2 AAV siRNA Pooled Vector
46003161 1.0 µg

SYT2 AAV siRNA Pooled Vector

Ask
View Details
EAF2 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06796 0.1 mg

EAF2 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Rat GPC2 shRNA Plasmid
abx987790-01 150 µg

Rat GPC2 shRNA Plasmid

Ask
View Details