Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal LASS2 Antibody
NBP3-17730-25ul 25 µL

Rabbit Polyclonal LASS2 Antibody

Ask
View Details
LAMC2 (NM_005562) Human Over-expression Lysate
LY417224 100 µg

LAMC2 (NM_005562) Human Over-expression Lysate

Ask
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS456404-01 48 Tests

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Ask
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS456404-02 96 Tests

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Ask
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS456404-03 5x 96 Tests

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Ask
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS456404-04 10x 96 Tests

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Ask
View Details