Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Cadherin-8 Antibody
NBP3-21402-100ul 100 µL

Rabbit Polyclonal Cadherin-8 Antibody

Ask
View Details
Pfkfb3 (NM_133232) Mouse Tagged Lenti ORF Clone
MR227638L4 10 µg

Pfkfb3 (NM_133232) Mouse Tagged Lenti ORF Clone

Ask
View Details
Rabbit Polyclonal FKBP15 Antibody [Alexa Fluor 488]
NB100-423AF488 0.1 mL

Rabbit Polyclonal FKBP15 Antibody [Alexa Fluor 488]

Ask
View Details
GABRB2, CT (GABRB2, Gamma-aminobutyric acid receptor subunit beta-2, GABA (A) receptor subunit beta-2) (Biotin) discontinued
035860-Biotin 200 µL

GABRB2, CT (GABRB2, Gamma-aminobutyric acid receptor subunit beta-2, GABA (A) receptor subunit beta-2) (Biotin) discontinued

Ask
View Details