Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sodium 2-(2-Amino-3-benzoylphenyl)acetate
TRC-S960130-10MG 10 mg

Sodium 2-(2-Amino-3-benzoylphenyl)acetate

Ask
View Details
ELAC1 (ED29, Zinc Phosphodiesterase ELAC Protein 1, Deleted in Ma29, ElaC Homolog Protein 1, Ribonuclease Z 1, tRNA 3 Endonuclease 1, tRNase Z 1) (APC)
126263-APC 100 µL

ELAC1 (ED29, Zinc Phosphodiesterase ELAC Protein 1, Deleted in Ma29, ElaC Homolog Protein 1, Ribonuclease Z 1, tRNA 3 Endonuclease 1, tRNase Z 1) (APC)

Ask
View Details
Lentiviral mouse Pon2 shRNA (UAS) - Lentiviral mouse Pon2 shRNA (UAS, GFP) plasmid
GTR15206122 1 Vial

Lentiviral mouse Pon2 shRNA (UAS) - Lentiviral mouse Pon2 shRNA (UAS, GFP) plasmid

Ask
View Details
Genesig Real-Time PCR detection kit for Chlamydophila abortus, Advanced
348844 1 Kit

Genesig Real-Time PCR detection kit for Chlamydophila abortus, Advanced

Ask
View Details
Recombinant Conus emaciatus Kappa-conotoxin-like Em11.8
MBS1051570-01 0.05 mg (E-Coli)

Recombinant Conus emaciatus Kappa-conotoxin-like Em11.8

Ask
View Details
Recombinant Conus emaciatus Kappa-conotoxin-like Em11.8
MBS1051570-02 0.2 mg (E-Coli)

Recombinant Conus emaciatus Kappa-conotoxin-like Em11.8

Ask
View Details