Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human XKRX sgRNA gene knockout kit - Lentiviral human XKRX sgRNA gene knockout kit (25)
GTR15394650 1 Vial

Lentiviral human XKRX sgRNA gene knockout kit - Lentiviral human XKRX sgRNA gene knockout kit (25)

Ask
View Details
Human TDGF1P3 qPCR Primer Pair
QH23921S 200 Tests

Human TDGF1P3 qPCR Primer Pair

Ask
View Details
Rat macrophage inflammatory protein 3α,MIP-3α ELISA Kit
CN-01595R1 96T

Rat macrophage inflammatory protein 3α,MIP-3α ELISA Kit

Ask
View Details
Recombinant Human SRP54 Protein, His, Insect-5ug
QP13591-5ug 5ug

Recombinant Human SRP54 Protein, His, Insect-5ug

Ask
View Details
Rat Fgf9 Pre-designed siRNA Set B
SI205054B 1 Each

Rat Fgf9 Pre-designed siRNA Set B

Ask
View Details