Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody (FITC)
abx270300-01 100 Tests

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody (FITC)

Ask
View Details
HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody (FITC)
abx270300-02 200 Tests

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody (FITC)

Ask
View Details
HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody (FITC)
abx270300-03 500 Tests

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody (FITC)

Ask
View Details
KIRAVIA Blue 520™ anti-mouse CD163
GT05619 100 µg

KIRAVIA Blue 520™ anti-mouse CD163

Ask
View Details
TSG101, CT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (PE) discontinued
T9101-75B-PE 200 µL

TSG101, CT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (PE) discontinued

Ask
View Details
Anti-SLC13A4 Antibody Picoband
MBS1759325-01 0.01 mg

Anti-SLC13A4 Antibody Picoband

Ask
View Details