Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His, solution), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek-293-his.html

Purity

98.0

Smiles

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 27.4 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ADAMTS6 Human shRNA Lentiviral Particle (Locus ID 11174)
TL316964V 500 µL Each

ADAMTS6 Human shRNA Lentiviral Particle (Locus ID 11174)

Ask
View Details
Donkey anti-Human IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 550 Conjugated
MBS3906982-01 0.5 mg

Donkey anti-Human IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 550 Conjugated

Ask
View Details
Donkey anti-Human IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 550 Conjugated
MBS3906982-02 5x 0.5 mg

Donkey anti-Human IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 550 Conjugated

Ask
View Details
Lambda Light Chain (Biotin) discontinued
L1185-15-Biotin 100 µL

Lambda Light Chain (Biotin) discontinued

Ask
View Details
Lentiviral mouse Snx6 shRNA (UAS) - Lentiviral mouse Snx6 shRNA (UAS) (100)
GTR15267162 1 Vial

Lentiviral mouse Snx6 shRNA (UAS) - Lentiviral mouse Snx6 shRNA (UAS) (100)

Ask
View Details
Rat ORM1 siRNA
abx927380-01 15 nmol

Rat ORM1 siRNA

Ask
View Details