Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Canine

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-canine.html

Purity

98.00

Smiles

SRHQSTLPEDDCTHFPASLPHMLRELRAAFGRVKTFFQMKDKLDNILLTGSLLEDFKSYLGCQALSEMIQFYLEEVMPRAENHDPDIKNHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIETYMTMRMKI

Molecular Formula

403628 (Gene_ID) XP_855560 (S20-I179) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Phenylpropiolamide
TRC-P400105-500MG 500 mg

3-Phenylpropiolamide

Sign In for Pricing
View Details
Acrp30 Mouse, HEK
OM296816-01 10 µg

Acrp30 Mouse, HEK

Sign In for Pricing
View Details
Acrp30 Mouse, HEK
OM296816-02 2 µg

Acrp30 Mouse, HEK

Sign In for Pricing
View Details
Acrp30 Mouse, HEK
OM296816-03 1 mg

Acrp30 Mouse, HEK

Sign In for Pricing
View Details
CYS1 (NM_001037160) Human Over-expression Lysate
LY422152 100 µg

CYS1 (NM_001037160) Human Over-expression Lysate

Sign In for Pricing
View Details
Munc18c (STXBP3) Rabbit Polyclonal Antibody
TA382175 100 µL

Munc18c (STXBP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details