Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Podoplanin, Human (HEK293, His)

The Podoplanin protein is a multifaceted regulator that affects cell migration and adhesion through multiple interactions. In hemo-lymphatic dissociation, Podoplanin binds to CLEC1B, triggering platelet activation that is counteracted by the CD9 interaction. Podoplanin Protein, Human (HEK293, His) is the recombinant human-derived Podoplanin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Podoplanin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/podoplanin-protein-human-hek-293-his.html

Purity

95.0

Smiles

ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL

Molecular Formula

10630 (Gene_ID) Q86YL7-1 (A23-L131) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-OIP106 / TRAK1 Antibody
OAEB02122-100UG 100 µg

Goat Anti-OIP106 / TRAK1 Antibody

Sign In for Pricing
View Details
Pipox sgRNA CRISPR Lentivector (Rat) (Target 1)
K6154802 1.0 µg DNA

Pipox sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
IRF8 Antibody
GWB-4DFDF6 0.1 mg

IRF8 Antibody

Sign In for Pricing
View Details
Type "J" thermocouple - 1/4" dia. X 6" long sheath; 72" leads with subminiature plug
108A TJ1/4-6 1 Each

Type "J" thermocouple - 1/4" dia. X 6" long sheath; 72" leads with subminiature plug

Sign In for Pricing
View Details
MMAC rabbit pAb
UB-GEN-8324 100 µL

MMAC rabbit pAb

Sign In for Pricing
View Details
Mammaglobin B/SCGB2A1 Protein, Human, Recombinant (hFc)
TMPY-00025-01 5 µg

Mammaglobin B/SCGB2A1 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details