Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JTB, Human (HEK293, Fc)

JTB proteins are critical for normal cytokinesis progression, regulate cell proliferation, and may serve as components of the chromosomal passenger complex (CPC) during mitosis. It interacts with key CPC components, affects AURKB activity, and exhibits anti-apoptotic properties, inhibiting TGFB1-induced apoptosis. JTB Protein, Human (HEK293, Fc) is the recombinant human-derived JTB protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

JTB Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jtb-protein-human-hek293-fc.html

Purity

90.00

Smiles

EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

Molecular Formula

10899 (Gene_ID) O76095-1 (E31-L105) (Accession)

Molecular Weight

Approximately 39 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENAH, CT (ENAH, MENA, Protein enabled homolog) (PE) discontinued
035067-PE 200 µL

ENAH, CT (ENAH, MENA, Protein enabled homolog) (PE) discontinued

Sign In for Pricing
View Details
Human IL-20 (Interleukin 20) Pre-Coated ELISA Kit
MBS669161-01 96 Tests

Human IL-20 (Interleukin 20) Pre-Coated ELISA Kit

Sign In for Pricing
View Details
Human IL-20 (Interleukin 20) Pre-Coated ELISA Kit
MBS669161-02 5x 96 Tests

Human IL-20 (Interleukin 20) Pre-Coated ELISA Kit

Sign In for Pricing
View Details
6-Bromo-3-cyclopropyl-1H-indazole
438056-01 100 mg

6-Bromo-3-cyclopropyl-1H-indazole

Sign In for Pricing
View Details
6-Bromo-3-cyclopropyl-1H-indazole
438056-02 250 mg

6-Bromo-3-cyclopropyl-1H-indazole

Sign In for Pricing
View Details
3- (3-Ethyl-1,2-oxazol-5-yl) propan-1-ol
RMC15100-01 50 mg

3- (3-Ethyl-1,2-oxazol-5-yl) propan-1-ol

Sign In for Pricing
View Details