Langerin/CD207, Human (HEK293, His)
CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Langerin/CD207 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/clec4k-cd207-protein-human-hek-293-his.html
Purity
98.0
Smiles
YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Molecular Formula
50489 (Gene_ID) AAH22278.1 (Y64-P328) (Accession)
Molecular Weight
30-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680050-100 1x 100 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682149-100 1x 100 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400718-100 1x 100 µL
HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 