Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Mouse (HEK293, His)

CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Mouse (HEK293, His) is produced in HEK293 cells with a N-Terminal His-tag. It consists of 88 amino acids (I22-A109) .

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-mouse-hek293-his.html

Purity

95.00

Smiles

ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA

Molecular Formula

55985 (Gene_ID) O55038 (I22-A109) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Jenh CH, et al. Human B cell-attracting chemokine 1 (BCA-1; CXCL13) is an agonist for the human CXCR3 receptor. Cytokine. 2001 Aug 7;15 (3) :113-21.|[2]Muzammal Hussain, et al. CXCL13/CXCR5 signaling axis in cancer. Life Sci. 2019 Jun 15;227:175-186.|[3]Marcelo G Kazanietz, et al. CXCL13 and Its Receptor CXCR5 in Cancer: Inflammation, Immune Response, and Beyond. Front Endocrinol (Lausanne) . 2019 Jul 12;10:471.|[4]Bao-Chun Jiang, et al. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5. J Clin Invest. 2016 Feb;126 (2) :745-61.|[5]Masayo Ukita, et al. CXCL13-producing CD4+ T cells accumulate in the early phase of tertiary lymphoid structures in ovarian cancer. JCI Insight. 2022 Jun 22;7 (12) :e157215.|[6]Feng Tian, et al. CXCL13 Promotes Osteogenic Differentiation of Mesenchymal Stem Cells by Inhibiting miR-23a Expression. Stem Cells Int. 2015;2015:632305.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Complement C3a Antibody (2B5) [DyLight 550]
NBP3-17997R 0.1 mL

Mouse Monoclonal Complement C3a Antibody (2B5) [DyLight 550]

Ask
View Details
MIR7037 Mouse qPCR Template Standard (MI0022886)
MK301023 200 Reactions

MIR7037 Mouse qPCR Template Standard (MI0022886)

Ask
View Details
Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit
MBS7239630-01 48 Well

Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit

Ask
View Details
Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit
MBS7239630-02 96 Well

Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit

Ask
View Details
Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit
MBS7239630-03 5x 96 Well

Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit

Ask
View Details
Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit
MBS7239630-04 10x 96 Well

Rat AN1-type zinc finger protein 1 (ZFAND1) ELISA Kit

Ask
View Details