Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA-1/CXCL13, Mouse (HEK293, His)

CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Mouse (HEK293, His) is produced in HEK293 cells with a N-Terminal His-tag. It consists of 88 amino acids (I22-A109) .

Product Specifications

Product Name Alternative

BCA-1/CXCL13 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-mouse-hek293-his.html

Purity

95.00

Smiles

ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA

Molecular Formula

55985 (Gene_ID) O55038 (I22-A109) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Jenh CH, et al. Human B cell-attracting chemokine 1 (BCA-1; CXCL13) is an agonist for the human CXCR3 receptor. Cytokine. 2001 Aug 7;15 (3) :113-21.|[2]Muzammal Hussain, et al. CXCL13/CXCR5 signaling axis in cancer. Life Sci. 2019 Jun 15;227:175-186.|[3]Marcelo G Kazanietz, et al. CXCL13 and Its Receptor CXCR5 in Cancer: Inflammation, Immune Response, and Beyond. Front Endocrinol (Lausanne) . 2019 Jul 12;10:471.|[4]Bao-Chun Jiang, et al. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5. J Clin Invest. 2016 Feb;126 (2) :745-61.|[5]Masayo Ukita, et al. CXCL13-producing CD4+ T cells accumulate in the early phase of tertiary lymphoid structures in ovarian cancer. JCI Insight. 2022 Jun 22;7 (12) :e157215.|[6]Feng Tian, et al. CXCL13 Promotes Osteogenic Differentiation of Mesenchymal Stem Cells by Inhibiting miR-23a Expression. Stem Cells Int. 2015;2015:632305.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Bad (Ser118) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5216R-BF647-01 20 µL

Phospho-Bad (Ser118) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Request Quote
View Details
Phospho-Bad (Ser118) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5216R-BF647-02 100 µL

Phospho-Bad (Ser118) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Request Quote
View Details
Mouse Bone Morphogenetic Protein 6 BMP6 ELISA Kit
BG-MUS10356-01 1 Each

Mouse Bone Morphogenetic Protein 6 BMP6 ELISA Kit

Request Quote
View Details
Mouse Bone Morphogenetic Protein 6 BMP6 ELISA Kit
BG-MUS10356-02 1 Each

Mouse Bone Morphogenetic Protein 6 BMP6 ELISA Kit

Request Quote
View Details
Mei1 (NM_028897) Mouse Tagged ORF Clone Lentiviral Particle
MR218964L3V 200 µL

Mei1 (NM_028897) Mouse Tagged ORF Clone Lentiviral Particle

Request Quote
View Details
HRP-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 3 (GSTa3)
MBS2045788-01 0.1 mL

HRP-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 3 (GSTa3)

Request Quote
View Details