Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Accessory factor US11 (US11)

Product Specifications

Product Name Alternative

Vmw21

Abbreviation

Recombinant Human herpesvirus 1 US11 protein

Gene Name

US11

UniProt

P04487

Expression Region

1-161aa

Organism

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Target Sequence

MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.2 kDa

References & Citations

"Phosphorylation of herpes simplex virus type 1 Us11 protein is independent of viral genome expression." Simonin D., Diaz J.-J., Kindbeiter K., Pernas P., Madjar J.-J. Electrophoresis 16:1317-1322 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BRCA1 Mouse Monoclonal Antibody [Clone ID: OTI6H10]
TA802733 100 µL

BRCA1 Mouse Monoclonal Antibody [Clone ID: OTI6H10]

Ask
View Details
Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)
MBS2096639-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)
MBS2096639-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)
MBS2096639-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)
MBS2096639-04 1 mL

Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)
MBS2096639-05 5 mL

Biotin-Linked Polyclonal Antibody to Actin Related Protein 2/3 Complex Subunit 2 (ARPC2)

Ask
View Details