Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SsPA, E. coli (His)

The ssPA protein specifically forms an equimolar complex with RNA polymerase holoenzyme (RNAP), thereby distinguishing its interaction preference from the core enzyme. ssPA is primarily synthesized during amino acid starvation and accounts for more than 50% of the total protein produced under these conditions. ssPA Protein, E. coli (His) is the recombinant E. coli-derived ssPA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SsPA Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sspa-protein-e-coli-his.html

Purity

98.0

Smiles

MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGAKELKGYMTRVFERDSFLASLTEAEREMRLGRS

Molecular Formula

61751941 (Gene_ID) P0ACA3 (M1-S212) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKMYT1 (Protein Kinase, Membrane Associated Tyrosine/threonine 1, MYT1) (MaxLight 650)
MBS6431806-01 0.1 mL

PKMYT1 (Protein Kinase, Membrane Associated Tyrosine/threonine 1, MYT1) (MaxLight 650)

Sign In for Pricing
View Details
PKMYT1 (Protein Kinase, Membrane Associated Tyrosine/threonine 1, MYT1) (MaxLight 650)
MBS6431806-02 5x 0.1 mL

PKMYT1 (Protein Kinase, Membrane Associated Tyrosine/threonine 1, MYT1) (MaxLight 650)

Sign In for Pricing
View Details
Rat POU domain, class 3, transcription factor 4 (POU3F4) ELISA Kit
AE26533RA-01 48 Tests

Rat POU domain, class 3, transcription factor 4 (POU3F4) ELISA Kit

Sign In for Pricing
View Details
Rat POU domain, class 3, transcription factor 4 (POU3F4) ELISA Kit
AE26533RA-02 96 Tests

Rat POU domain, class 3, transcription factor 4 (POU3F4) ELISA Kit

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF488A conjugate, 0.1mg/mL
BNC882673-100 1x 100 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRINS Adenovirus (Human)
37619051 1.0 mL

PRINS Adenovirus (Human)

Sign In for Pricing
View Details