Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CDNF, Mouse (His)

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA) -induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. Animal-Free CDNF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cdnf-protein-mouse-his.html

Purity

95.00

Smiles

MQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL

Molecular Formula

227526 (Gene_ID) Q8CC36 (Q25-L187) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexafluoroisopropyl isopropyl carbonate
PC450444 1 Each

Hexafluoroisopropyl isopropyl carbonate

Sign In for Pricing
View Details
CCN4 Human siRNA Oligo Duplex (Locus ID 8840)
SR305836 1 Kit

CCN4 Human siRNA Oligo Duplex (Locus ID 8840)

Sign In for Pricing
View Details
2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene
SGC56800-01 250 mg

2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene

Sign In for Pricing
View Details
2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene
SGC56800-02 2.5 g

2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene

Sign In for Pricing
View Details
Human Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 (NDST1) ELISA Kit
abx385200 96 Tests

Human Bifunctional Heparan Sulfate N-Deacetylase/N-Sulfotransferase 1 (NDST1) ELISA Kit

Sign In for Pricing
View Details
Anti-Acid phosphatase/ACP1 Antibody Picoband® Fluoro550 Conjugated
A02167-1-Fluoro550 100 µg/Vial

Anti-Acid phosphatase/ACP1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details