Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL2, Human (His)

PPIL2 exhibits ubiquitin-protein ligase activity, acting as an E3 ligase or ubiquitin-ubiquitin ligase, promoting “Lys-48”-linked polyubiquitination for proteasomal degradation of substrates.It acts as a chaperone to help transport BSG/Basigin to the cell membrane.PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PPIL2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppil2-protein-human-his.html

Purity

96.00

Smiles

GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP

Molecular Formula

23759 (Gene_ID) Q13356-2 (G280-P457) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)
MBS2125850-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)
MBS2125850-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)
MBS2125850-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)
MBS2125850-04 1 mL

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)
MBS2125850-05 5 mL

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)
MBS2125850-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Programmed Cell Death Protein 1 (PD1)

Ask
View Details