PPIL2, Human (His)
PPIL2 exhibits ubiquitin-protein ligase activity, acting as an E3 ligase or ubiquitin-ubiquitin ligase, promoting “Lys-48”-linked polyubiquitination for proteasomal degradation of substrates.It acts as a chaperone to help transport BSG/Basigin to the cell membrane.PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E.coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
PPIL2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ppil2-protein-human-his.html
Purity
96.00
Smiles
GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP
Molecular Formula
23759 (Gene_ID) Q13356-2 (G280-P457) (Accession)
Molecular Weight
Approximately 24 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details