Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial

Product Specifications

Product Name Alternative

Epithelial glycoprotein 314 Short name: EGP314 Short name: mEGP314 Protein 289A Tumor-associated calcium signal transducer 1 CD_antigen: CD326

Abbreviation

Recombinant Mouse Epcam protein, partial

Gene Name

Epcam

UniProt

Q99JW5

Expression Region

24-266aa

Organism

Mus musculus (Mouse)

Target Sequence

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cell-cell adhesion

Relevance

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant UPF0442 protein yjjB (yjjB)
orb2920632-01 20 µg

Recombinant UPF0442 protein yjjB (yjjB)

Sign In for Pricing
View Details
Recombinant UPF0442 protein yjjB (yjjB)
orb2920632-02 100 µg

Recombinant UPF0442 protein yjjB (yjjB)

Sign In for Pricing
View Details
Acetyl-XRCC6 (K542) (Ku-70, X-ray Repair Cross-complementing Protein 6)
304346-01 50 µg

Acetyl-XRCC6 (K542) (Ku-70, X-ray Repair Cross-complementing Protein 6)

Sign In for Pricing
View Details
Acetyl-XRCC6 (K542) (Ku-70, X-ray Repair Cross-complementing Protein 6)
304346-02 100 µg

Acetyl-XRCC6 (K542) (Ku-70, X-ray Repair Cross-complementing Protein 6)

Sign In for Pricing
View Details
Lentiviral mouse Azin1 shRNA (UAS) - Lentiviral mouseAzin1 shRNA (UAS, GFP) (25)
GTR15259640 1 Vial

Lentiviral mouse Azin1 shRNA (UAS) - Lentiviral mouseAzin1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
RPS6 Rabbit Polyclonal Antibody (APC-Cy7)
orb2284484 100 µL

RPS6 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details