Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial

Product Specifications

Product Name Alternative

Fibronectin type III domain containing 6 (FNDC6) (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (IL-20R2) (DIRS1)

Abbreviation

Recombinant Human IL20RB protein, partial

Gene Name

IL20RB

UniProt

Q6UXL0

Expression Region

30-233aa

Organism

Homo sapiens (Human)

Target Sequence

DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.9 kDa

References & Citations

"STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types." Dumoutier L., Leemans C., Lejeune D., Kotenko S.V., Renauld J.-C. J. Immunol. 167:3545-3549 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nestin/NES Monoclonal Antibody
AN200172P 100 µL

Nestin/NES Monoclonal Antibody

Sign In for Pricing
View Details
KIR2DL4 (NM_001080770) Human Over-expression Lysate
LY421108 100 µg

KIR2DL4 (NM_001080770) Human Over-expression Lysate

Sign In for Pricing
View Details
MRPS34 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C4]
TA505232AM 100 µL

MRPS34 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C4]

Sign In for Pricing
View Details
Spiramycin I (Contains up to 6% Spiramycin III)
TRC-S682300-2.5G 2.5 g

Spiramycin I (Contains up to 6% Spiramycin III)

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF405S conjugate, 0.1mg/mL
BNC041880-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCDC5 (NM_020869) Human Over-expression Lysate
LC434455 20 µg

DCDC5 (NM_020869) Human Over-expression Lysate

Sign In for Pricing
View Details