Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5R1, Human (His)

CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CYB5R1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyb5r1-protein-human-his.html

Purity

98.0

Smiles

LVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

Molecular Formula

51706 (Gene_ID) Q9UHQ9 (L29-Y305) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details