Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5R1, Human (His)

CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CYB5R1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyb5r1-protein-human-his.html

Purity

98.0

Smiles

LVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

Molecular Formula

51706 (Gene_ID) Q9UHQ9 (L29-Y305) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GATM Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA503147S 30 µL

GATM Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Ask
View Details
LOXL3, CT (LOXL3, LOXL, Lysyl oxidase homolog 3, Lysyl oxidase-like protein 3) (Biotin)
MBS6316759-01 0.2 mL

LOXL3, CT (LOXL3, LOXL, Lysyl oxidase homolog 3, Lysyl oxidase-like protein 3) (Biotin)

Ask
View Details
LOXL3, CT (LOXL3, LOXL, Lysyl oxidase homolog 3, Lysyl oxidase-like protein 3) (Biotin)
MBS6316759-02 5x 0.2 mL

LOXL3, CT (LOXL3, LOXL, Lysyl oxidase homolog 3, Lysyl oxidase-like protein 3) (Biotin)

Ask
View Details
PCK1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4972R-BF647 100 µL

PCK1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Ask
View Details
Cenpq (NM_001014215) Rat Tagged ORF Clone Lentiviral Particle
RR201291L4V 200 µL

Cenpq (NM_001014215) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human Protein kinase C gamma type, PRKCG ELISA KIT
ELI-12480h 96 Tests

Human Protein kinase C gamma type, PRKCG ELISA KIT

Ask
View Details