Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6E (LY6E)

Product Specifications

Product Name Alternative

Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1

Abbreviation

Recombinant Human LY6E protein

Gene Name

LY6E

UniProt

Q16553

Expression Region

21-101aa

Organism

Homo sapiens (Human)

Target Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA) . Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. ; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal SATB1 Antibody (S03-5H7)
NBP3-19810-50ul 50 µL

Rabbit Monoclonal SATB1 Antibody (S03-5H7)

Ask
View Details
Mouse Granzyme B ELISpot Kit
EL1865 1 Kit

Mouse Granzyme B ELISpot Kit

Ask
View Details
Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit
MBS9367149-01 48 Well

Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit

Ask
View Details
Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit
MBS9367149-02 96 Well

Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit

Ask
View Details
Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit
MBS9367149-03 5x 96 Well

Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit

Ask
View Details
Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit
MBS9367149-04 10x 96 Well

Human Protein Unc-13 Homolog A (UNC13A) ELISA Kit

Ask
View Details