Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arginase-1/ARG1, Human (C-His)

Arginase-1 Protein, Human (C-His) expresses in E. coli with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI) -resistant Hep3B tumor cells in mice[1].

Product Specifications

Product Name Alternative

Arginase-1/ARG1 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arginase-1-protein-human-his.html

Purity

95.20

Smiles

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKHHHHHH

Molecular Formula

383 (Gene_ID) P05089 (M1-K322) (Accession)

Molecular Weight

Approximately 40.0 kDa

References & Citations

[1]Sam-Mui Tsui, et al. Pegylated Derivatives of Recombinant Human Arginase (rhArg1) for Sustained in Vivo Activity in Cancer Therapy: Preparation, Characterization and Analysis of Their Pharmacodynamics in Vivo and in Vitro and Action Upon Hepatocellular Carcinoma Cell (HCC) . Cancer Cell Int. 2009 Apr 17;9:9.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl9 Protein Lysate (Rat) with C-HA Tag
15378036 100 µg

Ccl9 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human CRYAB Protein
E30P00088A 50 µg

Recombinant Human CRYAB Protein

Sign In for Pricing
View Details
Anti-Nop132 antibody
STJ94530 200 µl

Anti-Nop132 antibody

Sign In for Pricing
View Details
PRL-1 CRISPR/Cas9 KO Plasmid (h)
sc-416783 20 µg

PRL-1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Hexdc (NM_001001333) Mouse Tagged Lenti ORF Clone
MR207466L3 10 µg

Hexdc (NM_001001333) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Utp3 sgRNA CRISPR Lentivector set (Mouse)
K3524501 3x 1.0 µg

Utp3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details