Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIST, Human (His)

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PIST Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pist-protein-human-his.html

Purity

98.0

Smiles

IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Molecular Formula

57120 (Gene_ID) Q9HD26-1 (I286-Y462) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (PE)
MBS6386610-01 0.1 mL

NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (PE)

Ask
View Details
NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (PE)
MBS6386610-02 5x 0.1 mL

NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (PE)

Ask
View Details
Phb2 (NM_001013035) Rat Untagged Clone
RN206538 10 µg

Phb2 (NM_001013035) Rat Untagged Clone

Ask
View Details
UBE2CBP AAV siRNA Pooled Vector
48950161 1.0 µg

UBE2CBP AAV siRNA Pooled Vector

Ask
View Details
Pik3c2g (NM_207683) Mouse Untagged Clone
MC224617 10 µg

Pik3c2g (NM_207683) Mouse Untagged Clone

Ask
View Details