Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIST, Human (His)

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PIST Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pist-protein-human-his.html

Purity

98.0

Smiles

IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Molecular Formula

57120 (Gene_ID) Q9HD26-1 (I286-Y462) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RYK (Related To Receptor Tyrosine Kinase, JTK5, JTK5A, RYK1, JTK5A Protein Tyrosine Kinase)
364949 200 µL

RYK (Related To Receptor Tyrosine Kinase, JTK5, JTK5A, RYK1, JTK5A Protein Tyrosine Kinase)

Ask
View Details
Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
MBS2608183-01 48 Well

Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Ask
View Details
Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
MBS2608183-02 96 Well

Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Ask
View Details
Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
MBS2608183-03 5x 96 Well

Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Ask
View Details
Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
MBS2608183-04 10x 96 Well

Rabbit Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Ask
View Details
OR10J5 Antibody - C-terminal region
MBS3218818-01 0.1 mL

OR10J5 Antibody - C-terminal region

Ask
View Details