Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIST, Human (His)

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PIST Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pist-protein-human-his.html

Purity

98.0

Smiles

IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Molecular Formula

57120 (Gene_ID) Q9HD26-1 (I286-Y462) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [DyLight 350]
NBP2-98747UV 0.1 mL

Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [DyLight 350]

Ask
View Details
Mouse Monoclonal BTBD9 Antibody (BTBD9/7501) [Janelia Fluor 525]
NBP3-24035JF525 0.1 mL

Mouse Monoclonal BTBD9 Antibody (BTBD9/7501) [Janelia Fluor 525]

Ask
View Details
DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (MaxLight 490) discontinued
034813-ML490 100 µL

DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (MaxLight 490) discontinued

Ask
View Details
Mouse Monoclonal Aldolase B Antibody (OTI3C6) [FITC]
NBP2-70162F 0.1 mL

Mouse Monoclonal Aldolase B Antibody (OTI3C6) [FITC]

Ask
View Details
Rabbit anti-Escherichia coli (strain K12) fryB Polyclonal Antibody
MBS7148824 Inquire

Rabbit anti-Escherichia coli (strain K12) fryB Polyclonal Antibody

Ask
View Details