Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIST, Human (His)

PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PIST Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pist-protein-human-his.html

Purity

98.0

Smiles

IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Molecular Formula

57120 (Gene_ID) Q9HD26-1 (I286-Y462) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-associated Protein, nm23-H1) (AP)
MBS6387139-01 0.1 mL

NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-associated Protein, nm23-H1) (AP)

Ask
View Details
NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-associated Protein, nm23-H1) (AP)
MBS6387139-02 5x 0.1 mL

NME1 (NDPKA, NM23, Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-associated Protein, nm23-H1) (AP)

Ask
View Details
Pfdn6 (NM_212506) Rat Tagged Lenti ORF Clone
RR214741L4 10 µg

Pfdn6 (NM_212506) Rat Tagged Lenti ORF Clone

Ask
View Details
GFP hsa-miR-4520-5p AAV miRNA Vector
Amh1186500 500 ng

GFP hsa-miR-4520-5p AAV miRNA Vector

Ask
View Details
MAC3B Antibody
PHY7320A 150 μg

MAC3B Antibody

Ask
View Details
Rptn-set siRNA/shRNA/RNAi Lentivector (Mouse)
42723094 4x 500 ng

Rptn-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details