PIST, Human (His)
PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
PIST Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pist-protein-human-his.html
Purity
98.0
Smiles
IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Molecular Formula
57120 (Gene_ID) Q9HD26-1 (I286-Y462) (Accession)
Molecular Weight
Approximately 25 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details