Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Uricase (Uox)

Product Specifications

Product Name Alternative

(Urate oxidase)

Abbreviation

Recombinant Rat Uox protein

Gene Name

Uox

UniProt

P09118

Expression Region

2-303aa

Organism

Rattus norvegicus (Rat)

Target Sequence

AHYHDDYGKNDEVEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLRSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKGIKSIETFAMNICEHFLSSFSHVTRAHVYVEEVPWKRFEKNGVKHVHAFIHTPTGTHFCDVEQVRNGPPIIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYQNRDVDFEATWGAVRDIVLKKFAGPYDRGEYSPSVQKTLYDIQVLTLSQLPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVRRKLPSRL

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S) -allantoin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.9 kDa

References & Citations

"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues." Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF647 conjugate, 0.1mg/mL
BNC471810-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem80 (NM_027797) Mouse Tagged ORF Clone
MG200623 10 µg

Tmem80 (NM_027797) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human SIGLEC2/CD22 Protein (His Tag)
PDMH100369-01 20 µg

Recombinant Human SIGLEC2/CD22 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SIGLEC2/CD22 Protein (His Tag)
PDMH100369-02 100 µg

Recombinant Human SIGLEC2/CD22 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SIGLEC2/CD22 Protein (His Tag)
PDMH100369-03 500 µg

Recombinant Human SIGLEC2/CD22 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SIGLEC2/CD22 Protein (His Tag)
PDMH100369-04 1 mg

Recombinant Human SIGLEC2/CD22 Protein (His Tag)

Sign In for Pricing
View Details