Animal-Free IL-2, Pig (His)
IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-2 Protein, Pig (His), Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-2-protein-pig-his.html
Purity
98.0
Smiles
MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
Molecular Formula
396868 (Gene_ID) P26891 (A21-T154) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
