Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-23 alpha, Human (His)

IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. Animal-Free IL-23 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-23 p19 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-23 alpha Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-23-p19-protein-human-his.html

Purity

95.0

Smiles

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Molecular Formula

51561 (Gene_ID) Q9NPF7 (R20-P189) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC Cellufine A-500
19-805-51 5 x 1 ml

MC Cellufine A-500

Sign In for Pricing
View Details
Rabbit Polyclonal PDE1B Antibody [FITC]
NBP2-97975F 0.1 mL

Rabbit Polyclonal PDE1B Antibody [FITC]

Sign In for Pricing
View Details
LOC100360128 3'UTR GFP Stable Cell Line
TU257450 1.0 mL

LOC100360128 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GPR111 (ADGRF2) Human siRNA Oligo Duplex (Locus ID 222611)
SR326049 1 Kit

GPR111 (ADGRF2) Human siRNA Oligo Duplex (Locus ID 222611)

Sign In for Pricing
View Details
Mouse MYO16 siRNA
abx925199-01 15 nmol

Mouse MYO16 siRNA

Sign In for Pricing
View Details
Mouse MYO16 siRNA
abx925199-02 30 nmol

Mouse MYO16 siRNA

Sign In for Pricing
View Details