Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urocortin-3 (UCN3)

Product Specifications

Product Name Alternative

(Stresscopin) (Urocortin III) (Ucn III)

Abbreviation

Recombinant Human UCN3 protein

Gene Name

UCN3

UniProt

Q969E3

Expression Region

119-161aa

Organism

Homo sapiens (Human)

Target Sequence

KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.7 kDa

References & Citations

"Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor." Pal K., Swaminathan K., Xu H.E., Pioszak A.A. J. Biol. Chem. 285:40351-40361 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAG2, Control Peptide (Stromal Antigen 2, SA2, SA-2, Cohesin Subunit SA-2, SCC3 Homolog 2, SCC3B, bA517O1.1, DKFZp686P168, DKFZp781H1753, FLJ25871)
148551 100 µg

STAG2, Control Peptide (Stromal Antigen 2, SA2, SA-2, Cohesin Subunit SA-2, SCC3 Homolog 2, SCC3B, bA517O1.1, DKFZp686P168, DKFZp781H1753, FLJ25871)

Sign In for Pricing
View Details
DOLK Over-expression Lysate Product
GWB-775D61 0.1 mg

DOLK Over-expression Lysate Product

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)
MBS2120647-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)
MBS2120647-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)
MBS2120647-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)
MBS2120647-04 1 mL

Cy3-Linked Monoclonal Antibody to Heparanase (HPSE)

Sign In for Pricing
View Details