Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD157, Mouse (HEK293, His)

CD157 Protein, Mouse (HEK293, His) is a recombinant mouse CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule[1][2].

Product Specifications

Product Name Alternative

CD157 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd157-protein-mouse-hek293-his.html

Smiles

ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH

Molecular Formula

12182 (Gene_ID) Q64277 (A25-E285) (Accession)

Molecular Weight

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hussain AM, et, al. Functional expression of secreted mouse BST-1 in yeast. Protein Expr Purif. 1998 Feb;12 (1) :133-7.|[2]Ortolan E, et, al. CD157, the Janus of CD38 but with a unique personality. Cell Biochem Funct. 2002 Dec;20 (4) :309-22.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Porcine Granzyme M (GZMM) ELISA Kit
RDR-GZMM-p-01 96 Tests

Porcine Granzyme M (GZMM) ELISA Kit

Ask
View Details
Porcine Granzyme M (GZMM) ELISA Kit
RDR-GZMM-p-02 48 Tests

Porcine Granzyme M (GZMM) ELISA Kit

Ask
View Details
Ube2f (NM_001008381) Rat Tagged ORF Clone
RR208623 10 µg

Ube2f (NM_001008381) Rat Tagged ORF Clone

Ask
View Details
TLE2 Adenovirus (Mouse)
46757054 1.0 mL

TLE2 Adenovirus (Mouse)

Ask
View Details
Ppp1r36 (NM_001163103) Mouse Tagged ORF Clone
MG214302 10 µg

Ppp1r36 (NM_001163103) Mouse Tagged ORF Clone

Ask
View Details
Human CRYGA (NM_014617) AAV Particle
RC224787A1V 250 µL

Human CRYGA (NM_014617) AAV Particle

Ask
View Details