Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD157, Mouse (HEK293, His)

CD157 Protein, Mouse (HEK293, His) is a recombinant mouse CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule[1][2].

Product Specifications

Product Name Alternative

CD157 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd157-protein-mouse-hek293-his.html

Smiles

ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH

Molecular Formula

12182 (Gene_ID) Q64277 (A25-E285) (Accession)

Molecular Weight

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hussain AM, et, al. Functional expression of secreted mouse BST-1 in yeast. Protein Expr Purif. 1998 Feb;12 (1) :133-7.|[2]Ortolan E, et, al. CD157, the Janus of CD38 but with a unique personality. Cell Biochem Funct. 2002 Dec;20 (4) :309-22.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) ERG6 Polyclonal Antibody
MBS7180610 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) ERG6 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Tie-2 Antibody (MM0018-21G7) [Alexa Fluor 647]
NB110-60986AF647 0.1 mL

Mouse Monoclonal Tie-2 Antibody (MM0018-21G7) [Alexa Fluor 647]

Sign In for Pricing
View Details
MC-250-342-YL AF Systems Consumables
143232 Box of 1 Piece(s)

MC-250-342-YL AF Systems Consumables

Sign In for Pricing
View Details
RGD1566320 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6025808 1.0 µg DNA

RGD1566320 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rat homocysteine ELISA kit
QY-E11727 96 Tests

Rat homocysteine ELISA kit

Sign In for Pricing
View Details
NPS-1034
C12859-5mg 5 mg

NPS-1034

Sign In for Pricing
View Details