CD157, Mouse (HEK293, His)
CD157 Protein, Mouse (HEK293, His) is a recombinant mouse CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule[1][2].
Product Specifications
Product Name Alternative
CD157 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd157-protein-mouse-hek293-his.html
Smiles
ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH
Molecular Formula
12182 (Gene_ID) Q64277 (A25-E285) (Accession)
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Hussain AM, et, al. Functional expression of secreted mouse BST-1 in yeast. Protein Expr Purif. 1998 Feb;12 (1) :133-7.|[2]Ortolan E, et, al. CD157, the Janus of CD38 but with a unique personality. Cell Biochem Funct. 2002 Dec;20 (4) :309-22.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog