Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse OX-2 membrane glycoprotein (Cd200), partial

Product Specifications

Product Name Alternative

(MRC OX-2 antigen) (CD antigen CD200)

Abbreviation

Recombinant Mouse Cd200 protein, partial

Gene Name

Cd200

UniProt

O54901

Expression Region

31-232aa

Organism

Mus musculus (Mouse)

Target Sequence

QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.8 kDa

References & Citations

"Structures of CD200/CD200 receptor family and implications for topology, regulation, and evolution." Hatherley D., Lea S.M., Johnson S., Barclay A.N. Structure 21:820-832 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF 2 alpha (EPAS1) Human Gene Knockout Kit (CRISPR)
KN208604 1 Kit

HIF 2 alpha (EPAS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS623794 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Solution Reservoir
P7005 300 Units/Case

Solution Reservoir

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-1203
BCBS-1203 1 Unit

Biological Safety Cabinet Class II BCBS-1203

Sign In for Pricing
View Details
Mouse Mtmr1 activation kit by CRISPRa
GA205555 1 Kit

Mouse Mtmr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IL-13 Recombinant Rabbit monoclonal Antibody
HA725013 100 µL

Human IL-13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details