Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syntenin-1, Human (C-His)

Syntenin-1 is a multifunctional adapter protein that coordinates multiple cellular processes, including transmembrane protein trafficking, neural and immune regulation, exosome biogenesis, and tumorigenesis. It actively regulates TGFB1 signaling and enhances SMAD2/3 activation, TGFB1-induced epithelial-mesenchymal transition (EMT), and cell migration. Syntenin-1 Protein, Human (C-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Syntenin-1 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syntenin-1-protein-human-his.html

Purity

95.00

Smiles

SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Molecular Formula

6386 (Gene_ID) O00560 (S2-V298) (Accession)

Molecular Weight

Approximately 32.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Procollagen Type III N-Terminal Propeptide (PIIINP) CLIA Kit
abx196137 96 Tests

Rat Procollagen Type III N-Terminal Propeptide (PIIINP) CLIA Kit

Sign In for Pricing
View Details
Anti-INTS4 Antibody Picoband®, PE Conjugate
A13277-2-PE 100 µg/Vial

Anti-INTS4 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Complete Medium for Rat Renal Parenchymal Cells
abx704431-01 100 mL

Complete Medium for Rat Renal Parenchymal Cells

Sign In for Pricing
View Details
Complete Medium for Rat Renal Parenchymal Cells
abx704431-02 500 mL

Complete Medium for Rat Renal Parenchymal Cells

Sign In for Pricing
View Details
Nup205 (H-1) Alexa Fluor® 790
sc-377047 AF790 200 µg/mL

Nup205 (H-1) Alexa Fluor® 790

Sign In for Pricing
View Details
Rabbit Polyclonal NCAPH2 Antibody [HRP]
NBP1-28682H 0.1 mL

Rabbit Polyclonal NCAPH2 Antibody [HRP]

Sign In for Pricing
View Details