Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Feline (M36I, T56A, K126N)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Feline (M36I, T56A, K126N) is the recombinant GM-CSF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GM-CSF Protein, Feline (M36I, T56A, K126N), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-feline-m36i-t56a-k126n.html

Purity

96.00

Smiles

APTSSPSSVTRPWQHVDAIKEALSLLNNSSEITAVMNEAVEVVSEMFDPEEPKCLQTHLKLYEQGLRGSLISLKEPLRMMANHYKQHCPLTPETPCETQTITFKNFKENLKDFLFNNPFDCWGPDQK

Molecular Formula

493805 (Gene_ID) O62757/AAC06041 (A18-K144, M36I, T56A, K126N) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-500 1x 500 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details