Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Mouse (His)

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-mouse-his.html

Purity

98.0

Smiles

ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

Molecular Formula

20202 (Gene_ID) P31725 (A2-K113) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smek1 (PPP4R3A) (NM_032560) Human Over-expression Lysate
LC403177 20 µg

Smek1 (PPP4R3A) (NM_032560) Human Over-expression Lysate

Sign In for Pricing
View Details
OVCA1 (DPH1) Human Gene Knockout Kit (CRISPR)
KN421955 1 Kit

OVCA1 (DPH1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Portable Refrigerator BPOR-102
BPOR-102 1 Unit

Portable Refrigerator BPOR-102

Sign In for Pricing
View Details
Caspase 10 (CASP10) Human Gene Knockout Kit (CRISPR)
KN206379 1 Kit

Caspase 10 (CASP10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2716), CF647 conjugate, 0.1mg/mL
BNC472716-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2716), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS803103 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details