Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Mouse (His)

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-mouse-his.html

Purity

98.0

Smiles

ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

Molecular Formula

20202 (Gene_ID) P31725 (A2-K113) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smg7 Mouse Gene Knockout Kit (CRISPR)
KN516313 1 Kit

Smg7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-01 50 μL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-02 100 µL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-03 1 mL

CCL16 Antibody

Sign In for Pricing
View Details
Dopexamine Hydrochloride
TRC-D533900-5MG 5 mg

Dopexamine Hydrochloride

Sign In for Pricing
View Details
CHAC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A11]
TA507049AM 100 µL

CHAC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A11]

Sign In for Pricing
View Details