Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Mouse (His)

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-mouse-his.html

Purity

98.0

Smiles

ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

Molecular Formula

20202 (Gene_ID) P31725 (A2-K113) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), 0.2mg/mL
BNUB1994-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), 0.2mg/mL

Sign In for Pricing
View Details
PS2 (GE2), CF488A conjugate, 0.1mg/mL
BNC880677-500 1x 500 µL

PS2 (GE2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Syncollin (SYCN) activation kit by CRISPRa
GA117547 1 Kit

Human Syncollin (SYCN) activation kit by CRISPRa

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]
TA801325AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]

Sign In for Pricing
View Details
FAM3B (NM_058186) Human Recombinant Protein
TP309309M 100 µg

FAM3B (NM_058186) Human Recombinant Protein

Sign In for Pricing
View Details
6-Heptyn-1-ol
TRC-H288400-250MG 250 mg

6-Heptyn-1-ol

Sign In for Pricing
View Details