Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEB, E.coli (His-SUMO)

The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

SPEB Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/speb-protein-e-coli-his-sumo.html

Purity

90.0

Smiles

MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE

Molecular Formula

/ (Gene_ID) B7LFJ6 (M1-E306) (Accession)

Molecular Weight

Approximately 49.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 Recombinant Rabbit monoclonal Antibody
IRS019 100 µL

CD21 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF640R conjugate, 0.1mg/mL
BNC400901-100 1x 100 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GGCX Rabbit Polyclonal Antibody
TA369141 100 µL

GGCX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester
TRC-D430985-25MG 25 mg

N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester

Sign In for Pricing
View Details
BMPR2 (NM_001204) Human Recombinant Protein
TP720272M 50 µg

BMPR2 (NM_001204) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS647801 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details