Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEB, E.coli (His-SUMO)

The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

SPEB Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/speb-protein-e-coli-his-sumo.html

Purity

90.0

Smiles

MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE

Molecular Formula

/ (Gene_ID) B7LFJ6 (M1-E306) (Accession)

Molecular Weight

Approximately 49.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CVT 313 50 mg
6174/50 50 mg

CVT 313 50 mg

Sign In for Pricing
View Details
Rat Itpkb ELISA Kit
ELI-21123r 96 Tests

Rat Itpkb ELISA Kit

Sign In for Pricing
View Details
Recombinant Cellvibrio japonicus DNA mismatch repair protein mutL (mutL), partial
MBS1181935 Inquire

Recombinant Cellvibrio japonicus DNA mismatch repair protein mutL (mutL), partial

Sign In for Pricing
View Details
Recombinant Mouse CDNF Protein, N-His
E55P6131 50 µg

Recombinant Mouse CDNF Protein, N-His

Sign In for Pricing
View Details
Heterophdoid A
HY-147811 1 Each

Heterophdoid A

Sign In for Pricing
View Details
Bri3 (NM_001163709) Mouse Tagged ORF Clone Lentiviral Particle
MR215485L4V 200 µL

Bri3 (NM_001163709) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details