Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22R alpha 1, Canine (HEK293, His)

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Canine (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (M1-The226) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

IL-22R alpha 1 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22r-alpha-1-protein-canine-hek293-his.html

Purity

97.60

Smiles

AHIAEDTSDLLQYVKFQSSNFENILTWDSGLESAPDVVYSVEYKTYGKKEWLAKEGCQRITRKSCNLTTETGNHTEHYYARVTAVSAGGRSATKMTDRFSSMQQTTIKPPDVTCIPKVRSIQMIVHPTSTPIHAEDGHRLTLEDIFQDLFYRLELQVNHTYQMHLGGKQRDYEFIGLSPDTEFLGTITISVPNFFKESAPYVCRVKTLPDRT

Molecular Formula

612279 (Gene_ID) XP_855113.2 (A15-T226) (Accession)

Molecular Weight

Approximately 28-37 kDa

References & Citations

[1]Cui X, et, al. IL22 furthers malignant transformation of rat mesenchymal stem cells, possibly in association with IL22RA1/STAT3 signaling. Oncol Rep. 2019 Apr;41 (4) :2148-2158.|[2]Kragstrup TW, et, al. The IL-20 Cytokine Family in Rheumatoid Arthritis and Spondyloarthritis. Front Immunol. 2018 Sep 25;9:2226.|[3]Persaud L, et, al. Mechanism of Action and Applications of Interleukin 24 in Immunotherapy. Int J Mol Sci. 2016 Jun 2;17 (6) :869.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CD63 shRNA (UAS) - Lentiviral human CD63 shRNA (UAS, RFP) plasmid
GTR15320920 1 Vial

Lentiviral human CD63 shRNA (UAS) - Lentiviral human CD63 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Protein Wnt-2
orb1635538-01 50 µg

Protein Wnt-2

Sign In for Pricing
View Details
Protein Wnt-2
orb1635538-02 100 µg

Protein Wnt-2

Sign In for Pricing
View Details
Protein Wnt-2
orb1635538-03 1 mg

Protein Wnt-2

Sign In for Pricing
View Details
NCLN Antibody
A61757-50UL 50 μL

NCLN Antibody

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1)
MBS2166838-01 0.1 mL

Biotin-Linked Polyclonal Antibody to UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1)

Sign In for Pricing
View Details