Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HADHB, Human (GST)

HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

HADHB Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hadhb-protein-human-gst.html

Purity

90.00

Smiles

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Molecular Formula

3032 (Gene_ID) P55084-1 (A35-P283) (Accession)

Molecular Weight

Approximately 53.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISCU (NM_213595) Human Over-expression Lysate
LY403910 100 µg

ISCU (NM_213595) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-STAT1
Y158012 100 µg

Anti-STAT1

Sign In for Pricing
View Details
Human SIRT6 activation kit by CRISPRa
GA109867 1 Kit

Human SIRT6 activation kit by CRISPRa

Sign In for Pricing
View Details
Rtl9 Mouse Gene Knockout Kit (CRISPR)
KN514715 1 Kit

Rtl9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), CF647 conjugate, 0.1mg/mL
BNC471063-500 1x 500 µL

VEGF-A (VEGF/1063), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EP4 (PTGER4) Human Gene Knockout Kit (CRISPR)
KN210932RB 1 Kit

EP4 (PTGER4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details