Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HADHB, Human (GST)

HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

HADHB Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hadhb-protein-human-gst.html

Purity

90.00

Smiles

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Molecular Formula

3032 (Gene_ID) P55084-1 (A35-P283) (Accession)

Molecular Weight

Approximately 53.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Dipalmitoyl-2-chloropropanediol
TRC-D486840-25MG 25 mg

1,3-Dipalmitoyl-2-chloropropanediol

Sign In for Pricing
View Details
TTC32 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]
TA501340AM 100 µL

TTC32 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), Biotin conjugate, 0.1mg/mL
BNCB0979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caffeine
TRC-C080100-50G 50 g

Caffeine

Sign In for Pricing
View Details
XBP1 Human Gene Knockout Kit (CRISPR)
KN201959RB 1 Kit

XBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Znrf3 Mouse Gene Knockout Kit (CRISPR)
KN520131 1 Kit

Znrf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details