Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HADHB, Human (GST)

HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

HADHB Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hadhb-protein-human-gst.html

Purity

90.00

Smiles

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Molecular Formula

3032 (Gene_ID) P55084-1 (A35-P283) (Accession)

Molecular Weight

Approximately 53.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traf3ip2 Mouse Pre-designed siRNA Set A
HY-RS22078 1 Set

Traf3ip2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse ADK Protein, His, E.coli-100ug
QP10506-100ug 100ug

Recombinant Mouse ADK Protein, His, E.coli-100ug

Sign In for Pricing
View Details
Recombinant Human Cytochrome c/CYCS (C-His)
BP210-500ug 500 µg

Recombinant Human Cytochrome c/CYCS (C-His)

Sign In for Pricing
View Details
Recombinant Rat Ubiquinone biosynthesis protein COQ7 homolog (Coq7)
MBS1400477-01 0.02 mg (E-Coli)

Recombinant Rat Ubiquinone biosynthesis protein COQ7 homolog (Coq7)

Sign In for Pricing
View Details
Recombinant Rat Ubiquinone biosynthesis protein COQ7 homolog (Coq7)
MBS1400477-02 0.1 mg (E-Coli)

Recombinant Rat Ubiquinone biosynthesis protein COQ7 homolog (Coq7)

Sign In for Pricing
View Details
Recombinant Rat Ubiquinone biosynthesis protein COQ7 homolog (Coq7)
MBS1400477-03 0.02 mg (Yeast)

Recombinant Rat Ubiquinone biosynthesis protein COQ7 homolog (Coq7)

Sign In for Pricing
View Details